Enter domain:


Created: 2008-07-03
Expires: 2019-07-03
Domain IP: 1stshot.net
Name Servers: ns0.kagoya.net, ns1.kagoya.net
Registrar: GMO Internet, Inc. d/b/a Onamae.com
Alexa Stats: View here
Page Hits: 6
Google Links: View here
Yahoo Links: View here
AOL Links: View here
DDGo Links: View here
Bing Links: View here
Ask Links: View here
Yandex Links: View here
Sougou Links: View here
Baidu Links: View here

To date: January 12, 2019, 9:50 am


happychildhighschool.com   silksound.com   testcontainers.org   1stshot.net   tehnoros.ru   santarosaliaapartmenthomes.com   sberbank-business.ru   synergy.edu.ru   pinewoodinternationalschool.com   loveinmyoven.com   hermeticfilmfestival.com   europe-automatismes.com   rentlemoli.com   danieltenner.com   sarawebsolution.com   primarycarewalkinmedicalclinic.com   palox.org   enigmasoftwaregroup.com   myreservations.nl   optimusdigital.ro   daygamesecrets.com   tehnoros.ru   synergy.edu.ru   cronicasdeltercerplaneta.com.mx   cozumelwatersports.com   conversionesautoelectrico.com   shechoic.com   scftokenwallet.com   santaluciamobili.it   nintendoomed.it   nerdgt.it   kasrabaskoul.ir   karnosanat.ir   nakedbabesphotos.com   karakaryabi.com   musicpromo.it   mtelaborazioni.it   kalouttour.com   mrwatt.eu   mommoafrica.com   kalaasli.com   melty.it   kala-electric.ir   jwstech.co.uk   lampcore.ru   jscity.ir   krugle.com   jonoob-gsm.com   itcgenesis.ru   jommebazar.ir   jokarshop.com   jmkintl.com   jibpay.com   congresomexicanodelpetroleo.com   javahershop.com   javahersazi.ir   comextrendsconcurso.com.mx   cofocalec.org.mx   javaheriamir.com   cocoandnuts.co   cobatour.com   jahanara-art.com   jahadnasryazd.com   cnogfac.com.mx   gesap.it   jackreichert.com   jaabi.ir   clientesnina.com   formatradio.it   izkosar.ir   iwownfit.com   fiocchi.com   charreriacastillo.com.mx   cenube.com   itcn.ir   itbita.com   doyouall.it   isunsms.com   ccrequena.com.mx   cbtis165.edu.mx   cucinarefacile.com   istadisplays.com   consvi.it   iso-nik.com   cngas.ru   clubmilano.net   isatisdecor.com   cdn-news30.it   irwebco.com   bataloeast.org   cameralook.it   irsignal.ir   irkakla.ir   cbta35.com.mx   bridgemanimages.it   irgig.com   autohelpvideo.ru   askon-avesta.ru   casahectorpalacios.com.mx   ecole-sup-paris.fr   carnemax.com   cancun-hosting.com   canacintrasjr.com   bionote.com.mx   bimbosar.com.mx   bighusky.cz   bicyclelawyer.com   belissimo.com.mx   baessh.com.mx   iranzhinotours.com   aulavirtual.mx   iransmartagri.com   arquitecturaysociedad.com   iranpharmaco.ir   anv.mx   iranmist.ir   antipeek.com   ankui.mx   angelcupmexico.com   iranmarcopolo.org   agrodelnorte.com.mx   afjglobal.com   adesivojateadosp.com.br   iranesab.com   aceleradordeideas.com   accitrade.com.mx   iranasatir.com   1xbet.com.mx   weenfy.com   collection-politicalgraphics.org   vpracing.com   play123movies.com   upower.net   into-sea.com   samaragis.ru   intllaw.net   pressmen.info   easylivingoa.com   timedock.com   imenshahrvand.com   imenikala.com   talaclinics.net   sparkoverseas.com   skyforgearena.com   villagecamps.com   saafee.com   riyadhkey.com   rifaieonline.com   imen-technic.ir   imedito.com   simbiose.fr   selfventures.com   schoodicinstitute.org   iitopup.com   iheli.ir   idea-negar.com   panyouwang.com   icstss.com   mylaunchpadteam.com   icna.ir   icloudfa.com   my2030adds.com   mushroom-shaman.com   ic98.ir   mustsharak.com   mstayeb.com   ic-pacific.com   ibgco.ir   iaulamerd.ac.ir   iaror.org   msquaredkarting.com   iaat.ir   htns.com   mosineesoccer.com   matheuarchitects.com   hphamed.com   latinscrochetblog.com   ifbpt.org   erickmarolt.com   dpgoffroad.com   coachjoelle.com   clayfactorceramics.com   hoopadmachine.com   hookahfruits.net   hoobano.com   hollandgate-mohajerat.nl   hodapress.ir   hkysdisplay.com   hitexroidgroup.ir   hidanesh.ir   heyungroup.com   hengxingpolish.com   machovec.com   kldq.com.cn   jsraqar.com   injazgate.com   hopish.net   heimescorp.com   gsk-sd.com   granada-village.com   gogreensolvents.com   flarumone.com   healthhotel.ir   hanjere.com   handicraftarena.com   haminozad-co.ir   hamedcoffee.com   excitedvds.com   excel2mysql.com   hallmarkjobs.com   hakhashop.ir   evansvanodine.co.uk   engosoft.net   eetcmontada.com   hackingtutorial.org   gtravelonline.com   creadev.org   gsglobalstones.com   griffoncapital.com   cadsoul.com   grandprixnova.ro   grandliongroup.com   grandavenue.ro   gramik.com   gopc.info   gonbadkavooschat.ir   ansaribhasin.com   golrangtarabar.com   aljuref.com   aldar-est.com   globservices.net   glassyad.ir   alalson.com   aiwavoice.com   gheytoon.com   ghasreyakhco.com   uniformesdeportivosmedellin.com   ghasreeamn.com   siettcundinamarca.com   embera.co   consical.com.co   cafor.edu.co   buencomienzoantioquia.com   bachilleratodesdecasa.com   aseraseo.com   chonail.net   beverlyhillsfurniture2.com   yaygan.com   4xrti.net   futboltv-envivo.com   bhorersongbad.com   ghahremanzadeh.ir   genetics.ir   vladu.org   gd-honghua.com   ganjinearmanshahr.com   gamma-ir.com   gamersclubhouse.ir   gameaters.com   gajali.ir   vaporiumvapors.com   scholarship.app   linkeddominator.com   furniture-co.com   isocrates.com   freeimoffers.com   ghpassportonline.com   gizlikameramagazasi.com   lamphanmem.com   fotisto.ir   foodlandgrp.com   followbazar.ir   iraniantits.com   fipz.ir   filmzirnevis.ir   kenhtin.net   filfa.ir   rostov-almaz.ru   fazlgroup.com   ocpdata.org   medtran.ru   fatimahospital.ir   fasttrip.ir   rustyrazorblade.com   moyustore.com   farsi98.ir   miscw.com   bharatmoviewatchonline.com   bangalorearchdiocese.org   fargasht724.ir   viajarafrancia.com   farazpolymer.com   joveneshoy.org   farafarin.com   fanuse.ir   fanpaper.ir   falaghco.ir   wemoms.fr   visiter-voyager.info   eynaksedaghat.ir   thiercelin1809.com   eynak.biz   syfab.fr   expohelpcenter.com   retourverslecinema.com   expertscouncil.com   rectif2000.com   evacuation-well-gholami.ir   europelilliput.com   matevi-france.com   intendancezone.net   idbuffet.com   editions-ieps.com   e-chronologie.org   drapeauxunic.fr   escapehome.ir   goldenslot45.com   esamar.ir   brunotritsch.fr   erteashvalve.com   eranetwork.ir   auvergnerhonealpes.bio   autoaxe.fr   arduinospro.com   dentalprom.ru   canagon.com   bilwadeh.com   epg-llc.com   eeradicalization.com   eminencepass.com   elecomhub.com   euro-fishing.eu   mirkinohd.ru   eivc.ir   borozdin-art.ru   saludynoticia.com   umantravel.com.ua   expedicia.org   wfdp-igo.org   warriors.id   aquabeadsart.com   smartbabywatch.ru   betechno.ru   slingshotnyc.tv   eco4science.org   mammaagata.com   easyopening.ir   e-icdl.ir   drrashn.ir   tenfactorialrocks.com   scraptools.com.ua   drmjeps.com   drkhoshraj.ir   thekratomshop.eu   dr-taherian.ir   dr-jahangir.com   dr-eslamian.com   ellinikiparagogi.com   dr-ameryoun.com   dpservers.com   downloadtank.com   dottm.ir   razvitiesluha.ru   szpitalmadalinskiego.pl   exploitsmotivation.com   dorosti.com   donyayehoney.ir   dokall.com   doctor-rostami.ir   dmpro.ir   digiyadak.com   digitalzoomstudio.net   digipasazh.ir   digiintex.com   diamondeditors.com   moon-event.fr   hd-film24.ru   thinkanalytics.com   strimzi.io   pplprs.co.uk   helixecommerce.com   fauna-servis.ua   semenivka.com.ua   idealeague.org   dgk.co.ir   10ticks.co.uk   wpspec.com   mebeos.ru   schoutenglobal.com   deypt.com   pamw.pl   hotuser.ru   delisafamily.com   coolitsystems.com   survey-app.co   lauralion.info   helplazy.com   genesiscare.com   evablanes.com   deepstash.com   decoradin.com   spreement.com   decoprimeshop.com   dddweekly.com   saime.com   datageography.com   daryantravel.com   daruhome.com   kuwaitpress.net   nomadfox.fr   nalunch.ru   mikroifadeleronline.com   zmangas.com   crecover.com   starpointonline.com.br   sorteplay.com   sladefitness.com.br   inesnet.ru   sistematodos.com.br   sandyvozeexpressao.com   skulptorbl.com   onumismata.com   ravnopravnorazliciti.org   darkoobad.com   neumanntour.com.br   dargolfarsh.ir   glowinsta.com   jornaldomingo.com.br   dahian-co.com   ioiobrasil.org   dabirefarsi.com   daaagh.ir   cut-laser.ir   warsense.ru   softclipper.net   culhamlab.com   crosssport.ir   priem-metalla.ru   cps.ir   voolx.com   concretegeometric.com   imobento.com.br   emailageconnect.com   daladierlima.com   santehnik-yga.ru   contraktor.com.br   compulabs.com.br   clinicavalinhos.com.br   bluemcare.com   aaonline.com.br   iclim.ru   companysms.ir   7n-news.com   fingerprintjs.com   cmms.ir   deragonselection.com   cloudminingpro.net   khatitime.com   clinicmb.com   clinicava.com   genesismoba.com   run-and-travel.com   clearepoxy.ir   clikers.org   hidglobal.fr   bestkv.com   zagreev.ru   xl-films.ru   wrubl.com   chobara.ir   chinacaclco.com   wingssystems.com   voyagejapan.com   chilliesncream.co.uk   ultraautocenter.net   chidemanonline.com   chess.ir   turkmenistan.it   cherike.ir   chelika.com   truemql.com   traveloturkmenistan.com   chadorekhakiemadar.ir   teswirler.com   cghe.ir   susbi.com   cgcenter.ir   cfont.ir   supermaxautos.com   sidasturkiye.com   shinymould.com   setilend.ru   cenway.com   sendekodyaz.com   ceg-co.com   sbs.com.ua   sametgonez.com   grez-doiceau.be   salut154.ru   sahinsoyticaret.net   rus-kino.ru   rosatom-easteurope.com   theshortform.com   side-hustleapp.com   cbico.co   cave-finder.ir   castellomare.com   duckhouse.com   ronnierodriguez.com   relaxmusics.ru   camikala.com   cafelezat.com   pravoleg.ru   businessclinicbh.com   nordpos.com   bristolhomebites.co.uk   briantaylorphotography.com   nikokiuru.com   nexitally.com   bizimbazar.com   bitgeram.ir   bita-pasargad.com   bistoondairy.com   msu-online.ru   mir-master.com   mhn.de   localmilfshookup.com   lansys.com.ua   kd6.ru   jurdefinans.com   biogol.ir   ihtiyacodasi.com   bineshenik.com   herfstloop.com   bimeiran6576.com   halkmarket.org   mayovera.com   bimegaronline.com   sachascott.com   bigsoole.com   quanben.me   losmovieunblocked.com   dosug-serpuhov.ru   webdevelopmentinstitute.com   schoolknot.com   betaprj.ir   besharateno.com   bent-hospital.ir   behnazdavari.com   behinyab-co.ir   behinatile.ir   behbahanno.ir   bbe.ir   gld.cn   galaxymaniatm.com   gadamsiyakhat.com   free-soft.net   fqps.org   football-mipt.ru   flexstoneinc.com   batisimengroup.com   florentcolletweb.com   bascocut.net   filmoz.net   baronet.ir   barnamerizi.ir   sudak-aquapark.com   banehroz.com   bama360.ir   baltires.com   seoalarb.com   bshwat.cc   baharantravel.ir   englishdomain.eu   mlytics.com   badansaaz.ir   azvir.com   azarris.com   azarmehrpars.ir   eltex.org   azarayaz.com   ayathosseini.com   avstudio.ir   avidehpardaz.com   vaprondigital.com   avayenasim.com   trustedunion.com   avatebb.ir   eho.eu   ava-film.ir   drivermql.ru   atlasjahadi.ir   drawstitch.com   atinegariran.ir   dizigundemi.com   atabatesemnan.ir   dijiatolye.com   develpower.com   clashofclans2.ru   bemp4.com   ashaes.com   asemanshir.com   aziyatravel.com   asansazanlift.com   asia-service.net   aryanduke.com   apprtools.ru   andovercg.com   artmise.ir   alphaeurope.com   arte-graphic.com   scertwb.org   aromaticsone.com   3anet.com.ua   arianaebd.com   3-core.ru   arenart.com   you-bible.com   arcplus.ir   coko1.ru   arcfamily.com   arbabatravel.com   macbdoil.co.uk   aradmetal.ir   aradkafsh-co.com   aradbeton.com   araam.ir   retailroyal.com   vo1tdepository.com   apadanaled.ir   kesaritex.com   apachefood.com   antutu.ir   antivirusiranian.ir   ansar-al-mahdi.com   anisetan.com   androiding.ir   grandlife.nl   emaillistee.com   qcashbd.com   andeh.ir   anad.net   amoozeshplc.ir   amlaktabriz.ir   aminfarhang.ir   amanzadeh.com   amanghatekarshop.com   alptabriz.ir   alololeh.com   almonqez.org   allmediaprint.com   alhaidary.co   alborzkise.com   alborzfco.com   al-reefy.com   aha.ir   tr-plus.net   thepixeltribe.com   sante-zdravotni-obuv.cz   zenggi.com   yubu.nl   werkenbijgelre.nl   vlab.nl   agahiban.com   afzoon.net   tiemenkamp.com   thepiratebeach.net   base501.com   tdfs.ru   aftabplast.com   slachtofferhulp.nl   shutterexperience.nl   samourais.nl   probbqshop.nl   panelzz.com   gethigrade.com   opposuits.nl   ndmag.net   mogema.nl   martin.be   mariagefreres.co.jp   lutonbennett.co.uk   livit.nl   kvnijnsel.nl   jollybytes.nl   ismtf.org   ijmnl.org   hetrughuis.nl   helfterkamp.nl   havensteder.nl   ewo.com   eteck.nl   erik-vd-veen.nl   eetbarebloemenshop.nl   adamiyatpress.ir   deaardebreda.nl   homeandtek.com   adali-habitat.fr   d-kapriz.ru   acadanesh.com   cloud2.nl   businbedrijf.nl   abzarsell.com   brokery24.ru   briswarenhuis.nl   abzarazmayesh.com   abianpharmed.com   abhilashaip.com   abfa-fars.ir   abanenergy.com   aamout.com   aalibaba.ir   aadaan-tarh.com   a-petgar.com   69download.ir   5xtabarok.com   3st.ir   motoroy.pl   3shomareapp.ir   3d360.ir   35111.ir   30doc.ir   1sun.ir   scusjewelry.com   1mohajer.ir   1ls.ir   townmp3.com   voiptraffic.net   1karbalad.com   1dars.com   autoccasion.be   zusedigital.com   zumbo.com   zakairan.com   yamahamotorcyclesports.com   kraskadoma.ru   worldyoganews.com   estel-spb.com   tomas-bjorkman.com   filesgeter.ru   whatblakedoes.com   westernstrikers.com   wescoatvillage.com   welgrow.co.id   weaved.com   wandboard.org   moviztime.com   voiceyourvalues.org   vividchinese.blog   visaapplicationaustralia.com   villamasbro.com   cccam-full.com   vernonsystems.com   neutroroberts.it   vastosoft.com   vashbags.com   mystrollers.com   user-sdt.com   usedtruck.org   unforgettableimpact.com   tylsen.com   studiorayyan.com   tyedyemary.com   tuppencecollective.co.uk   sunten.com.tw   routerp.com   ppgorich.com   tredfashion.com   marecielo.com   tokyodepot.com   togninishair.com   tnrfm.com   lovechild.com.tw   hosterica.com   homecmf.com   thomas-larkin.com   fun-kid-fun.com   thextraordinary.org   fueki.co.jp   elifetw.com   dreamy.com.tw   doublesquare.com.tw   designyxr.com   dawnbaby.com.tw   brinkman-uitgeverij.nl   bossystemen.nl   beststyleliving.nl   barendonk.nl   artclaysilvershop.nl   champion23.com   apipf.com   thesaxshack.co.uk   thepyjamafoundation.com   thematte.com   animalfoodexpress.nl   afriditraders.com   2crore.com   thelayar.com   irf.ua   thekivaspa.com   thediv-net.com   kuluvalley.com   fundus.eu   circologeneralitrieste.com   thebaxleybondi.com   thebabyscorner.be   thaiwahclub.com   tecevo.com   rjzk.com.cn   mwo.com.br   tallguyrunning.com   talicotech.com   etwew.com   storeonanimeonline.com   kerch-most.ru   romametropolitane.it   uos.ua   astrometa.ru   mir-vozduha.ru   web-dizz.com   swoonpatterns.com   swintps.net   swarna.id   sustainableminds.com   santengineeringindustries.com   sugarroseteapartyhire.com   haberwebte.com   sudocue.net   suchmaschinen-optimierung-seo.org   stellabeaustickerco.com   ladsolutions.com   aquaparksopot.pl   bets4you.biz   stanselms.org   fulcrumdigital.com   sbmmkemenagmakassar.com   sheynovo-ag.eu   omoniya.com   builtforimpact.net   bnaeopc.com   ardeco-bg.com   ihaegitimi.com   aimer-jesus.com   l2-firebird.com   spectrumaurora.com   4trumpfmedical.com   itutorial.ro   startupeuropeclub.eu   eps-turbo.de   cuponas.ro   righthuntjob.com   huratips.com   simple-remedies.com   hp-opt.com.ua   techsirenblog.com   socomd.com   thedigitalgal.com   vacayvisionary.com   social-influencers.com   georgestoyanov.com   chucknorrisfacts.net   boohugger.com   artofbeingamom.com   unnamedart.com   cliniccards.com   dochzemli.ru   ulsd.net   throttledownkustoms.com   swintonsart.com   shootersworldonline.com   selvanegra.us   meesteresvernice.nl   lovenails-shop.de   robertbullockbride.com   pedulla.com   lionspark.dk   smarthealthywomenacademy.com   armourandcastings.com   nathanvossconstruction.com   ingabless.com   slatterymedia.com   1000000diy.ru   prideinnparadise.com   lapidleadersafrica.com   gsmnigeria.com   exchangepaddy.com   elshaddaisalvation.org   aladetechnologies.com   film-review.org   efmaroc.org   hostdango.com   goodtimesaccra.com   gbeyewear.com   simplysilkbeauty.com   ewayproled.com   earthrugs.com   cumingmicrowave.com   simonrogan.co.uk   rogueheist.com   booiks.com   bagsheaven.cn   phillipsj.net   azroseco.com   silkscarf-winery.com   r2hm.com   junaidperfumes.com   jacobsclevenger.com   generatepattern.com   gemsandvibes.com   doraprojects.net   geomares-marketing.com   pumpupboats.com   shelftalkers.com   nnoi.ru   sfcapital.co.id   9abilatalarbe7s.com   greenplanet.net   dolceitaly.ru   villaday.ir   sandrakim.com   ressel.se