Enter domain:


 

 
 
guts.ca
Created: 2002-11-06
Expires: 2019-11-05
Domain IP: 54.221.207.100
Name Servers: ns1.domainmanager.com, 35.168.57.191, ns2.domainmanager.com, 107.20.195.169
Registrar: (10dollar.ca) 10 Dollar Domain Names Inc.
Alexa Stats: View here
Page Hits: 11
Google Links: View here
Yahoo Links: View here
AOL Links: View here
DDGo Links: View here
Bing Links: View here
Ask Links: View here
Yandex Links: View here
Sougou Links: View here
Baidu Links: View here

To date: January 12, 2019, 8:35 am

Domains:

electronicid.eu   g7operadora.com.br   guts.ca   tehranpet.com   thefloatingtv.com   riosat.ru   skandix.de   frecuenciaalbirroja.com   farrahfunerals.com   baevibes.com   hypemasters.com   game-shop1.ir   bayigene.com   cazipalisveris.com   caginburo.com   alimagazalari.com   rexbo.net   roswellpark.org   sweatelite.co   alantron.net   ds.se   alimagazalari.com   akroneshotel.com   webuza.com   samplewrittenemergencyactionplan.com   annuities.net   1appmarket.com   languagereach.com   pro100cho.ru   visualrheumatology.ru   technologics.ru   kyhnia.net   bestinterracialtube.com   brookesandpartners.com   3sk.tv   artesianbottling.com   svadba-plus.ru   pacificbulbsociety.org   humansas.com   codigogeek.com   variethe.de   unlockguy.net   quickstartinternetmarketing.com   numerotelephone.net   moulinsurmer.com   megaboxhdapkdownload.com   genesefoundation.org   collectif-haiti.fr   antenne509.com   advocacytraining.org.uk   circuitpeople.com   landforlady.ru   tuyetdinhvolam.net   topapkdownload.com   tinhkhongphapngu.net   timdatxe.com   thietkehomexinh.com   thienthanhbao.com   sukien-fo4-garena.com   sieuthiketsatketbac.com   santaniavigne.com   rtworkspace.com   ongnhuatienphong.com   luatvietnam.net   kinhdoanhdiaoc.net   inppgiare.info   hero-mu.net   haler.net   dungcuykhoatiendung.com   donganhtravel.com   dogogiakho.com   chuyengiatuanle.com   buongiagoc.com   kenyandigest.com   zeffs.ru   upokupka-spb.ru   eprimebank.com   flamencodance.ru   hopemediakenya.org   fb2books.com   elearningmoo.com   chicinchicago.com   apollo13.eu   nik-center.ru   pronk.ru   windmillprotea.com   pacelawoffice.com   theoldecharityshoppe.org   suoanemsomi.com   stratushop.co   silverburg.eu   seharhgsmservices.com   workonlineathomeforfree.com   rugcouture.com   ramsem.com   policypassport.com   myflexiworklife.com   my-freewill.com   moreleta.org   kwaitokoeksister.com   kwadiwaranch.com   jeannellelamourbridal.com   internationalprobiotics.org   hcicoal.com   hallofshame.com   genesis-eco.com   forex-fundamental-analysis.com   fineworkcnc.com   ctrack-anz.com   coins4jam.com   citl-tz.com   catherinemac.com   brigadoongroup.com   beardenthusiasts.com   barbiemovies.net   tursvit.info   vidursoft.com   albadr.org   viewxtra.com   realmadrid-1x2.com   coalitionagainsttyphoid.org   santehnikat32.ru   japzap.ru   thelace.com.ua   windsorbusiness.com   velocafeyyc.com   thecommonwealth-educationhub.net   fif.com.pl   onexglobal.com   solarbollardlighting.com   arsnet.org   yarfortuna.ru   vivaface.info   lesopilka777.ru   joma.biz   champeycookingclass.com   kody-na-sims.ru   ellyblog.com   tumblemath.com   soundredux.io   skal.nl   kikotapasando.com   corenv.net   belituda.com   juaristi.com   yoquieromipaginaweb.com   wolkimobile.com   wahio.com   vitalespas.com   viralteam.com.co   vidrieraotun.com.co   veroprieto.com   velvetfoods.com.co   upshot.org.uk   transplatino.co   thelittlegym.com.co   termaleslosvolcanes.com   terapiasctj.com   tecnologicadeloriente.edu.co   tconpoint.com   surtitodo.com.co   surrss.com   sro.com.co   solmaq.com   skylink-wf.com   skbergecolombia.com   skapshois.com   sitcomunicaciones.co   sistemadetoxrojo.com   search-assistance.com   sccg33.org   satpcs.com.co   rethosconsultora.com   reinomalvino.com   puntosabroso.com.co   premiumfilters.co   petuniaropa.com   petspa.com.co   ojotele.com   nuevasaludips.com   notaria14medellin.com.co   mydeserttc.com   murphy.edu.co   moneymakerarea.com   mobiltepremia.com.co   mazonia.fr   mastechno.com   marketingvip.co   mabe.com.co   lobofutbol.com   limideco.edu.co   lax965.com   lapalmaesvida.com   labrika.com   juanlibros.com   jccollection.co   iquoteb2b.com   intercaster.com.co   intenalco.edu.co   infoawards.org   humalib.com.co   gulrentacar.com   grupogersas.com.co   grupoarben.com   grandlucayan.com   gmo.com.co   garciamelo.com   franquiciascolombia.co   extremeworld.com.co   expresateconglobos.com   escuelaprimaria.net   escribecuandollegues.com   elrincondelvinotinto.com   ecoimpresion.com.co   digitalcentersas.com   dicoplast.com.co   desiredrealestateservices.com   cubicus.co   ctsaul.com   cruzrojasantander.org   codigo-postal.com.co   clubdhuchi.com   ccto.com.co   cbimedellin.com   breakfastboxbog.com   brandwayn.com   boomgaludigital.com   bolsoswayuu.com.co   bodyht.com   autodato.com   atelieraldente.de   aseoslaperfeccion.com   articuloseureka.com   articulosaltagama.com   arawakplaza.com   aprendamosmatematicas.com   allegion.com.co   alchemytc.com   musicspheregroup.com   aicold.org   a5s.co   zsegw.pl   meblownia.pl   infoloty.pl   24mm.co   microafzar.ir   galaxynote8root.com   batumirent.com   trainline.pl   alveus.pl   errgo.ru   colegio-san-antonio.org   pro-kletochki.ru   zionutrition.com   zazuminc.com   yict.com.cn   yeahtutoriales.com   yachtingsouthamerica.com   xn--hvormyekanjeglne-qob.com   weir3d.de   wearefusion.co.uk   watches-zone.com   warleywasps.net   vulcanometal.com   vixert.com   terravan4x4.com   vilardebomortensen.com   videoclaro.com   vicenteparrilla.com   vfxblend.com   verydoge.net   morrow-house.com   vas.com   vaninja.com   usfinancegeneral.com   usableyaccesible.com   universoanimal.co   universitymanorhawaii.com   unfolder.app   udpiler.com   ubereatschile.info   turnotronics.com   turismoamir.com   turbosawmillusa.com   tuhost.mx   tualiadoencasa.com   trkattachments.com   triviar.com   tripsniffer.com.br   traplentos.com   transparenciaciudadana.org   transgalaxia.com   topfotografia.net   tomoswap.com   tomasdabas.eu   pego.it   todocraneos.com   tiendamoller.com   tiendadeastronomia.com   thexfilesonline.com   thequalis.com   theentrepreneurssourcediscovery.com   theartcenteronline.com   tenischile2012.com   teknaria.com   tecnomatica.org   tecnoma.com   tdhlizarraga.com   takalirsa.fr   swiftsurprises.me   sweetsoulrecords.com   soluma.pl   radioplus.pl   plantwear.pl   mlppolska.pl   e-timberland.pl   sugardaddyprogram.com   studio-rhodes.com   sttarmac.com   streamsespanol.com   stacjajakuszyce.pl   spottergps.uk   soyninjamami.com   sophieguitar.com   songster.com   sombrero-blanco.com   soltecvillena.com   sobrenatural.tv   smiledesignerpro.com   smartfitkit.com   sitiosaojorge.com.br   sinoficios.net   silvialagataconbotas.com   shopvivavida.com   shopexmall.com   shamsularifeen.com   sevipag.com   setcoaching.com   servebuddy.com   serruriershouilles.fr   seonatural.net   sekkeicosplay.com   seguridadpy.info   seguridadinformaticaactual.com   seducirmujeres.net   sect.com.cn   santiagohermes.com   sandamaso.com   sallita.net   saldo-bip.com   saam.com   rvfpopular.net   rufianrevista.org   rowermevo.pl   rosycisneros.net   rodaggiofilm.com   rileditores.com   rhyta.com   renarena.net   regioncaribe.org   redtarapaca.com   redatacama.com   reciclalibre.com   recetarioblog.com   recargafacil.com   radiomanque.org   putlocker-solarmovie.com   purenatural.com.mx   puppis.com.co   pumarino.org   puertosalinacruz.com.mx   publichouseofart.com   proyectoronline.com   proyectoacceso.com   protistas.com   propanogas.com   promocionatuevento.com   statehealthpolicy.org   productostop.com   prodelta.it   prizmatix.com   platformvr.net   platformavr.com   planet-earth-movement.org   piopiopiopa.com   pickydays.com   phutawanshop.com   petshopcolombia.com   easygifts.com.pl   minimaxy.pl   peceras.info   lubsport.pl   laznia.pl   kaktusa.pl   pcalmacen.com   paraisosfiscales.net   papofacil.com.br   papeleriaalmargen.com   ovnispain.com   oscarandlucy.com   ortopediaymas.com   opensoc.io   open-tibia.com   onlinejuegosgratis.net   oncotypeiq.com   omprod.eu   ok-regist.ru   nykroro.com   novared.net   netrunner.com   netfliex.com   nbport.com.cn   nakedhdphotos.com   myastitu.ru   musicbizz.tv   mundomascotapetshop.com   pantheongallery.com   multimagendiagnostica.com   mueblesaguado.com   mudango.com   msilhk.com   mpichi1.com   movimiento-moderno.com   motelcozumel.com   sublost.ir   modezapk.com   modayestilodevida.com   mng-chile.com   miuniversoverde.com   milrecursos.com   michaelcampos.com.br   miblogalinstante.com   metragenll.com   meteochile.com   metaltreewallart.net   mentoresdeimpacto.org   feelgoodorganic.com   mauriciotolosa.com   masteriptv.net   marketinglovers.net   manualdeacuario.org   maniobradebuques.com   mammana.org   mamilmaneras.com   marriagebureau.com   mamaeducadora.com   maltashipphotos.com   makeeverything.tv   maguytran-pinterville.com   londonthamesport.co.uk   livingjuice.com   thebutterflymom.com   leoblackbeltinsales.com   lauren-hodges.com   latitude-outdoor.com   latincacs2019.com   latiendadebicicletas.com   laspeceras.com   lasmanzanas.net   lanetadelascuerdas.com   lanasrubi.com   lamemoriadelpan.com   lalleva.com   lacorrientenicaragua.org   labrujacontacondeaguja.com   kuoshuchile.com   kubobcat.com   kadrihel.com   junrecetas.com   jetsmart-aerolinea.com   javnew.org   5course.com   japonentreamigos.com   jaleoriojano.com   ivital.mx   iptvchileno.com   integramedica.com   intecopr.com   insurancesnext.com   institutonutrigenomica.com   insertechno.com   ingenieria2030.org   imusicdata.cz   ingekids.com   infovets.com   info-contactomedipass.com   inexchile.com   incoeditsearch.co   incacode.com   impresorascanonperu.com   iguannarock.com   iglesiaadventistaagape.org   hugovalenciatattooist.com   hotline-web.com   hotelespresidente.com   hostalgreenhouse.com   restaurant-china.com   horalibredotblog.com   homeupgradespecialist.com   historiadeandalucia.com   happypetsco.com   hanshinport.co.jp   guitarlandia.com   grupopayroll.com   grupolaserdisc.com   gouiric.com   emisorasdominicanas.com   gesnex.com   geoadaptive.com   gdotg.com   gasfiteriadonernesto.com   gaoxiang.org   galimatazo.com   fusiondesigninc.com   fusiondesign.com.mx   fusionboston.com   fundaciongala.com   fundacion-milenio.org   functiodomo.com   fullpeladitas.com   franciscoleal.net   fotosde.eu   formadorestic.com   focusonland.com   fly-bumblebee.com   firbiotech.com   fiordoaustral.com   financecredittloan.com   ffrickstudio.com   ferrepernos.com   femae.org   farmedicalcorp.net   facesontheradio.com   expertise-team.com   exmagazineonline.com   euroports.com   euroclimaplus.org   estreams.tv   estlandro.cc   estaticos.net   escuelagobierno.org   encuentrometalurgia.com   em-kaelectric.com   elpiquetero.org   elpedaldelguitarrista.com   elitehookupshere1.com   edurioja.org   educacionmachali.net   editors-official.com   editorialeas.com   e-guasch.com   duomoediciones.com   dunkerque-port.fr   ductosparabasuracolectori.com   dualdesignstudio.com   drywallperu.net   drilldrivervs.com   dreesecode.com   dragonskip.com   dpworldsouthampton.com   downthisvideo.com   divanchile.com   disfrutasingapur.com   digitaliselectronics.com   dibujoscolorear.net   diariosustentable.com   dhmaterialmedico.com   devir.com   despedidasdesolterabarcelona.net   descargarappvalley.com   descargandolo.com   deproductos.co   deportes365.com   defensaadventista.com   deepfakelove.com   damicoship.com   dainachaviano.com   cyberleopard.com   cursos-diplomados-gratis.com   csj66.org   cryptobankandtrust.co.uk   crossfitnwt.com   cristinamadoni.com   creativekismet.com   coscocs.com   cosasinoxidables.com   ledeliziedicagliostro.it   speerstragymnastics.nl   congresoseaav.com   comunidaddelabiblia.org   complethost.com   comoleerlabiblia.org   com-chile.com   coinmarketnewstoday.com   codigolite.com   cockbox.org   clinicamuc.com   clinicadentalavilesyroman.com   cleopatrart.com   claritichile.com   ckp-cz.cz   civicbrain.io   cimet.com   chilesorprendente.com   chilepork.com   chilefixer.com   chathu.me   ch-sistemas.com   cementerio.org   celeinaann.com   ceeod.mx   cctvcenter.com   catholicauthors.com   castilruiz.com   picopia.cn   carrerasvespertinas.com   camilaciskew.com   calculaconatecyr.com   bytenoise.co.uk   burovaldes.com   buffettorres.com.br   buenosmotores.com   bspmoscoso.com   breckfoundation.org   bordadosmanuelaromero.com   bookingagentsdirectory.com   bogracity24.com   bobcatsservice.com   bluehosting.mx   blue-sketch.com   blendmexico.com   binarias.co   bfprods.com   bepersis.com   becasparachilenos.com   bbqstore.it   banahosting.org   babel3d.com   azradiolatina.com   azarproducciones.com   azafranruedo.com   siteperform.com   scrap-sf.org   arriendoasegurado.com   arcadienvios.com   aquachile.com   api-ux.com   apfsc.com   andresmatematica.com   america-digital.com   alonsodeercilla.net   almeriatrending.com   almadeaventura.com   ahyun.org   aginternacional.com   adventistasregiomontana.org   adriyverofkd.blog   adide.org   adgoritmo.com   adan-ca.com   actioncoachsureste.com   achinados.net   acelerap.net   accessibleweb.com   33grados.net   sevenbilliontoday.com   suorkearboutique.com   shopkins.com.mx   work-club.com   tuitt.com   tap-usa.com   shoppersmateph.com   restoreyoureconomy.org   onlineinnovations.com   obs6.com   nurseregistry.com   mannkiawaz.com   lucrativephotography.com   kingfiles.net   katarinaphang.com   jujuassociation.com   imagesix.org   ijeeee.org   hotelhesperia.com   harbingerlearning.com   grtrck.com   glovue.com   game-keyz.info   forumagic.org   forbesgroup.eu   eusoc.com   embassyvietnam.org   designews.org   czettner.com   cultivatingculture.com   connsensebulletin.com   centsible-sawyer.com   carouselbroadway.com   brandonspanishsda.com   bornhoeved.info   albarkka.com   affiliescommando.com   sumo-east.ru   tongmingniao.com   nadiaretailbanking.com   lotime.it   citcarabia.com   bydeeaus.com   broadwaybakery.com   balancingnutrients.com   sazi-group.ru   smrgaki.ru   lapakairsoft.com   fanzyzone.com   adimg.ru   mxmedia.ru   college-edu.ru   chiasefb.com   triprintmaroc.com   geofdb.com   monique.com   torcuatomanzo.com   the-nose.com   straighthoodie.com   serviciopanamericano.com   lotexweb.com   hschmidt.com   cursodeoratoria.com   comunicadosdeprensa.co   afrik-consult.com   trio-service.ru   nataliarice.com   pbbarcouncil.com   mastfun4u.com   kickcric.com   ilyassaeed.com   hellohafiz.com   elzargaa.com   kinokubik.biz   cryptocraft.com   bookhotac.com   airfull.ru   mortimer-russia.ru   edemnayug.com   prog-ramma.ru   wpitchoune.net   wallions.com   verzekeringvergelijken.info   randl.com.tw   otemae.ac.jp   ot-a-do-ya.org   offroadtyres.ru   off-travel.ru   mou5.com   jiku-chu.com   asusdesign.com   99baiduyun.com   apec-center.ru   academcity.org   chiponeic.com   murim.ru   magmid.ru   fotomania.org   civilniy.org.ua   zfresh-news.com   sro-ngs.com   pchipa.com   rarbg-torrents.com   zygpharma.com   youthgamesfoundation.com   yournaukrinews.com   yoobuddy.com   yogeshwaripolytechnic.com   yogapad.de   yebelieve.com   yashcollege.org   xsbpk.com   xiamenacademy.org   xceybuy.com   worldtricks4u.com   worldreviewer.com   worldjm.org   world-inline-cup.com   workspace-guru.com   workshopq.com   womenperfectsolution.com   wn1designs.com   wkvedu.com   winsaartechnologies.com   wilsonhall.org   wildfirecorp.co   whitespaceagrocare.com   whitehallresources.co.uk   westmaharashtrachapter-ifs.com   wenexagrowth.com   webdeveloperny.com   webappsquad.com   wearekrishna.com   wcclg.com   wallstep.com   waiscanada.com   wahegurulive.com   waaw1.tv   vvipflight.com   vtcglobal.net   vrrbuilders.com   voxtechnologies.com   vivadiploma.org   visualfabriq.com   visitcapture.com   vishnuhrsolution.com   vipmachineries.com   viplovechs.com   viol8.com   vinyoflex.com   vidyarthikhadi.com   velsvidyashram.com   vedicastrologyblog.com   vchartservices.com   vardaangroup.com   vadhuvar.info   urbanbusiness.co   ultrazen21.com   twinegadget.com   twill.io   tunerstop.com   trinitycalcium.com   trencor.net   traveltriangles.com   travelex.net   transasianchamber.org   traitgain.com   trackolap.com   touristattractions.co   toawaken.org   tk-international.com   tillandyield.com   tibich.com   threepiececompany.com   thirdcoastpi.com   third3place.com   theweddingroses.com   thewearablenews.com   theresearchexpo.com   thepizzabasket.com   themagicalmedia.com   thekarmayogi.blog   thejobcrowd.com   thedigitalindia.com   thebungalowsahmedabad.com   thebgesschool.com   thebeardhood.com   the360stores.com   the10xzone.com   tgfsalon.com   tezpage.com   testovation.com   test2016.com   tenanter.com   teknoelectro.com   techsikho.com   techmixing.com   teamveelog.com   teambrewhouse.org   taynaeventsindia.com   tasteofranchi.com   target-holding.nl   talkinggames.net   talentdiscoveri.com   tagonmedia.com   sysc.org   synramprojects.com   syncorsol.com   swift-online.com   swamiramsukhdasji.org   surveyexpress.info   surasaraswathisabha.org   superplasts.com   sumanjo.com   sudivivah.com   stutorialz.com   stlcorp.com   stepupaligarh.com   steadycaremedical.com   statenews.net   starthq.com   stapleagro.com   srkeducare.com   srisubrahmanyaswamydevalayamskandagiri.org   sricapital.com   spreadthetalks.com   spotafile.com   splendorlaminates.com   speedbagforum.com   specieconservation.org   spacelogistics.co.uk   sonamgroup.com   sonacardiac.com   softgentechnologies.com   socialhackettes.com   snsacademy.org   skylogisticshub.com   skyflingpro.com   skilljharkhand.org   sjzniexin.com   sitesearch360.com   simpsonyachtcharter.com   silverspringdailyphoto.com   sijcon.com   signalsmedia.com   shqfab.com   shortclicky.com   shop4impact.org   shivmohanband.com   shivkrupaenterprise.com   shivaoutdoorfurniture.com   shivangyoga.com   shivalikgroup.com   shankarmultimedia.com   shakvihimam.com   shadownethost.com